- ARHGAP40 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-94111
- Human
- ARHGAP40
- 0.1 ml (also 25ul)
- This antibody was developed against Recombinant Protein corresponding to amino acids: PNLFLHQGRP PKLPKGKEKQ LAEGAAEVVQ IMVHYQDLLW TVASFLVAQV RKLNDSSSRR PQLCDAGLKT WLRRMHADR
- Unconjugated
- Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- Rabbit
- PBS (pH 7.2) and 40% Glycerol
- C20orf95, dJ1100H13.4
- Rho GTPase activating protein 40
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
PNLFLHQGRPPKLPKGKEKQLAEGAAEVVQIMVHYQDLLWTVASFLVAQVRKLNDSSSRRPQLCDAGLKTWLRRMHADR
Specifications/Features
Available conjugates: Unconjugated